PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004490466.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 208aa    MW: 23897.2 Da    PI: 9.9173
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004490466.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF871.1e-271059251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    ri+n++ rqvtfskRrng+lKKA+EL +LCdaev +iifsstgkly+++s
  XP_004490466.1 10 RIDNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGIIIFSSTGKLYDFAS 59
                    8***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.833161IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-39160IPR002100Transcription factor, MADS-box
CDDcd002655.04E-43276No hitNo description
SuperFamilySSF554552.49E-31280IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-28323IPR002100Transcription factor, MADS-box
PfamPF003191.9E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-283859IPR002100Transcription factor, MADS-box
PfamPF014861.2E-2784170IPR002487Transcription factor, K-box
PROSITE profilePS5129715.72286177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010440Biological Processstomatal lineage progression
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGLLK KAKELAILCD AEVGIIIFSS TGKLYDFAST  60
SMRSVIDRFN KSKEESNQLG NAASEIKFWQ REAAMLRQQL HNLQESHRQI MGEELSGLTV  120
KELRSLENQL EISLRGVRMK KDQLLTNEIQ ELNRKGDIIQ QENEELYKKV YGTKHENGIN  180
RNSVFTVSLD IEDNLHVPVN LQLSQPQQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D3e-19274173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C3e-19274173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B3e-19274173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A3e-19274173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J5e-19282181Myocyte-specific enhancer factor 2A
3p57_I5e-19282181Myocyte-specific enhancer factor 2A
3p57_D5e-19282181Myocyte-specific enhancer factor 2A
3p57_C5e-19282181Myocyte-specific enhancer factor 2A
3p57_B5e-19282181Myocyte-specific enhancer factor 2A
3p57_A5e-19282181Myocyte-specific enhancer factor 2A
3kov_J5e-19282181Myocyte-specific enhancer factor 2A
3kov_I5e-19282181Myocyte-specific enhancer factor 2A
3kov_B5e-19282181Myocyte-specific enhancer factor 2A
3kov_A5e-19282181Myocyte-specific enhancer factor 2A
1tqe_S6e-19174174Myocyte-specific enhancer factor 2B
1tqe_R6e-19174174Myocyte-specific enhancer factor 2B
1tqe_Q6e-19174174Myocyte-specific enhancer factor 2B
1tqe_P6e-19174174Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00410DAPTransfer from AT3G57230Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankMSU919641e-154U91964.1 Medicago sativa MADS-box protein mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012568392.11e-151PREDICTED: MADS-box transcription factor 23-like isoform X4
RefseqXP_004490466.11e-151PREDICTED: MADS-box transcription factor 23-like isoform X4
SwissprotQ6EP496e-99MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLV7B6T71e-121V7B6T7_PHAVU; Uncharacterized protein (Fragment)
STRINGGLYMA14G36221.11e-120(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.11e-97AGAMOUS-like 16